Peptides
All Peptides ★ Seeds Pillar Peptides FDA Status Tracker
Tools
Which Peptide Is Right? Peptide Comparison Design Lab
Guides
What Is a Peptide Peptide Therapy Guide Seeds Protocols Collagen Peptides Skincare Peptides Blog & Articles
Encyclopedia
Peptide Encyclopedia
For Practitioners
Sourcing Standards FAQ
For Students
Flashcards MCAT Practice NEET Practice Study Guide
Peptide Deep Dive

CJC-1295

Growth Hormone Releasing Hormone Analog · GHRH · DAC

A 30-amino-acid synthetic analog of growth hormone-releasing hormone (GHRH) modified for extended half-life. Often combined with Ipamorelin (a growth hormone secretagogue). One of the most popular peptides in the biohacking and anti-aging communities.

30 amino acids
GHRH analog
DAC for long half-life
Not FDA-approved
Often paired with Ipamorelin
By PeptideBond Editorial Team·Sources: PubMed, FDA.gov, published clinical trials·Last updated: March 2026
Educational only — not medical advice.Disclaimer
Category
Growth Hormone Releasing
Route
SC injection
Half-life
~6-8 days (with DAC)
Human Data
Phase II trials
Evidence
Moderate clinical

What Is CJC-1295?

CJC-1295 is a synthetic 30-amino-acid peptide analog of the first 29 amino acids of human growth hormone-releasing hormone (GHRH 1-29, also known as Sermorelin). It was developed by ConjuChem Biotechnologies with a key innovation: the addition of a Drug Affinity Complex (DAC) — a reactive chemical group that covalently binds to serum albumin after injection.

CJC-1295 is commonly paired with Ipamorelin, a pentapeptide growth hormone secretagogue that acts on the ghrelin receptor (GHS-R). Together, they provide complementary stimulation of growth hormone release — CJC-1295 mimics the natural GHRH signal while Ipamorelin amplifies it through a separate receptor pathway.

Core Concept
CJC-1295 stimulates growth hormone release by binding to the GHRH receptor on pituitary somatotroph cells, triggering the Gs-cAMP-PKA signaling cascade that promotes GH gene transcription and secretion. The DAC modification covalently attaches CJC-1295 to albumin in vivo, extending its half-life from ~30 minutes (native GHRH) to 6-8 days, maintaining elevated GH pulsatility without the supraphysiological spikes seen with direct GH injection.

CJC-1295 was originally developed by ConjuChem Biotechnologies and has been studied in both its DAC (Drug Affinity Complex) and non-DAC forms. The DAC version uses a maleimido-proprionic acid linker that binds covalently to serum albumin after injection, extending the half-life to approximately 6-8 days and enabling once-weekly dosing. The non-DAC version (sometimes called "Modified GRF 1-29") has a much shorter half-life of approximately 30 minutes, requiring more frequent administration but providing more pulsatile GH release that some clinicians consider more physiological.

In clinical practice, CJC-1295 is most commonly used in combination with ipamorelin — a pairing sometimes called the "CJC/Ipa stack." The rationale is synergistic: CJC-1295 provides sustained GHRH-receptor stimulation (like pressing the accelerator), while ipamorelin provides ghrelin-receptor stimulation (like releasing the brake). Together, they produce a greater GH pulse than either peptide alone. This combination has been one of the most widely prescribed growth hormone secretagogue protocols in anti-aging and functional medicine.

CJC-1295 was placed on the FDA's Category 2 restricted list in late 2023. Its status under the February 2026 HHS reclassification announcement is uncertain — it may be among the approximately 5 peptides that remain on Category 2 due to safety concerns, particularly cardiac side effects reported in some studies. Practitioners should monitor the FDA's formal guidance for final determination.

>Structure & Sequence

CJC-1295
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
MW: 3,647.28 Da · 30 residues
Open in Design Lab →

Mechanism of Action

CJC-1295 binds the GHRH receptor on anterior pituitary somatotrophs, activating the Gs-adenylyl cyclase-cAMP-PKA cascade. This stimulates both GH gene transcription and release of stored GH granules. Unlike exogenous GH injection (which suppresses the body's own GH production via negative feedback), CJC-1295 works through the natural signaling axis, preserving the pulsatile pattern of GH secretion that is important for optimal tissue response.

CJC-1295 GH Stimulation
CJC-1295
binds GHRH receptor
Activates
Gs → cAMP → PKA
Stimulates
GH gene transcription
Pituitary
releases Growth Hormone
GH acts on
Liver → IGF-1
Result
Growth, repair, metabolism

Key Mechanisms

PathwayEffectSignificance
GH releaseStimulates pulsatile GH secretion from pituitary somatotrophsIncreases GH levels 2-10x above baseline for days
IGF-1 increaseGH stimulates hepatic IGF-1 productionMediates most of GH's anabolic effects on muscle, bone, and connective tissue
Fat metabolismGH promotes lipolysis in adipose tissueReduces body fat percentage, particularly visceral fat
Albumin binding (DAC)Reactive group forms covalent bond with Cys34 of serum albuminExtends half-life from ~30 min to 6-8 days
Preserved pulsatilityWorks through the natural GHRH axisAvoids the flat GH levels and side effects of direct GH injection

Evidence Base

StudyDesignFindingsLevel
Phase I/II (ConjuChem)Human trials, n=small2-10x increase in GH levels sustained for 6+ days after single dose; dose-dependent IGF-1 increaseLevel II
Body compositionClinical studyIncreased lean mass, decreased fat mass over 12 weeks in GH-deficient subjectsLevel II
Ipamorelin comboClinical researchSynergistic GH release when CJC-1295 + Ipamorelin administered togetherLevel II-III
Sleep qualityObservationalAnecdotal and small-study reports of improved deep sleep (GH is primarily released during slow-wave sleep)Level III-IV

Safety & Side Effects

GH-related side effects: Because CJC-1295 elevates growth hormone and IGF-1 levels, it can produce side effects associated with GH excess: water retention, joint pain, carpal tunnel-like symptoms, and numbness or tingling in the extremities. These effects are dose-dependent and typically resolve with dose reduction.

Cardiac concerns: Some clinical and post-marketing reports have associated CJC-1295 (particularly the DAC version) with cardiac side effects including palpitations and, in rare cases, more serious cardiac events. These reports are one reason CJC-1295 may remain on the Category 2 list. The non-DAC version, with its shorter duration of action, may carry less cardiac risk, though this has not been definitively established.

Cortisol and prolactin: Unlike some other GH secretagogues (particularly GHRP-6), CJC-1295 does not significantly elevate cortisol or prolactin levels at standard doses, which is considered a favorable characteristic.

Long-term safety: No long-term safety studies (beyond 12 months) have been published for CJC-1295 in humans. Theoretical concerns about chronic GH/IGF-1 elevation include potential effects on cancer risk, glucose metabolism, and joint health, though none of these have been confirmed in the available data.

Regulatory Status

JurisdictionStatus
FDANot approved. ConjuChem's clinical program was discontinued.
WADABanned under S2 (Peptide hormones and growth factors)
Legal statusAvailable as a research chemical in many jurisdictions

Analyze in Design Lab

Explore More Peptides

Browse the full directory.

Full Directory →