Home Encyclopedia What Is a Peptide Therapy Guide Blog Flashcards MCAT Practice NEET Practice Design Lab Clinical Docs AI Dashboard
Peptide Deep Dive · Evidence-Based Review

Semaglutide

GLP-1 Receptor Agonist · Ozempic · Wegovy · Rybelsus

A 31-amino-acid GLP-1 analog engineered for once-weekly dosing. FDA-approved for Type 2 diabetes and obesity. Achieves 15-17% body weight loss — the most effective anti-obesity peptide drug on the market.

31 amino acids
~7 day half-life
FDA approved
15-17% weight loss
Once weekly dosing
Educational content only. Not medical advice. This peptide may not be FDA-approved. Full disclaimer →
Category
GLP-1 Agonist
Route
SC injection / oral
Dose
0.25–2.4 mg/week
Approval
FDA 2017/2021
Evidence
Phase III RCTs

What Is Semaglutide?

Semaglutide is a synthetic analog of glucagon-like peptide-1 (GLP-1), an incretin hormone naturally secreted by intestinal L-cells after eating. It is 94% structurally similar to native human GLP-1 but has been engineered with three key modifications that extend its half-life from 2 minutes to approximately 7 days.

Marketed as Ozempic (diabetes), Wegovy (weight loss), and Rybelsus (oral diabetes), semaglutide has become the most commercially successful peptide drug in history. In the STEP clinical trial program, patients lost an average of 15-17% of their body weight — results previously achievable only through bariatric surgery.

Core Concept
Semaglutide works by mimicking the natural GLP-1 hormone: it stimulates insulin secretion only when blood sugar is high (glucose-dependent), suppresses glucagon release, slows gastric emptying, and acts on hypothalamic appetite centers to reduce hunger and increase satiety. Its three structural modifications — Aib8 for DPP-4 resistance, Arg34 substitution, and C18 fatty acid for albumin binding — transform a 2-minute hormone into a once-weekly medication.

Amino Acid Sequence

Semaglutide Primary Structure
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 4,113.6 Da · 31 residues · 94% homology to native GLP-1 · 3 key modifications
Open in Design Lab →

The sequence contains a high proportion of charged and polar residues, making native GLP-1 highly hydrophilic — which contributes to its rapid renal clearance (and 2-minute half-life). The C18 fatty acid conjugation at Lys26 fundamentally changes the pharmacokinetics by enabling albumin binding.

Mechanism of Action

Semaglutide binds to and activates the GLP-1 receptor, a G protein-coupled receptor (GPCR) expressed in the pancreas, GI tract, heart, kidneys, and brain. Activation triggers adenylyl cyclase → cAMP → PKA signaling, with different downstream effects depending on the tissue.

In the pancreas, it enhances glucose-dependent insulin secretion from β-cells and suppresses glucagon from α-cells. In the brain, it crosses the blood-brain barrier and activates satiety neurons (POMC/CART) while inhibiting hunger neurons (NPY/AgRP) in the arcuate nucleus of the hypothalamus. In the stomach, it slows gastric emptying, prolonging the feeling of fullness after meals.

Semaglutide Mechanism of Action
Binds
GLP-1 Receptor
Activates
Gαs → cAMP
Stimulates
Insulin release
Suppresses
Glucagon
CNS action
Hypothalamus
Result
Satiety + Weight Loss

The three structural modifications that make semaglutide clinically viable are: (1) Aib at position 8 — α-aminoisobutyric acid replaces alanine, creating steric hindrance that blocks DPP-4 from cleaving the peptide at its primary degradation site; (2) Arg34 replacing Lys34, preventing fatty acid attachment at the wrong position; (3) C18 fatty diacid at Lys26 via a mini-PEG linker, enabling non-covalent binding to serum albumin (half-life ~19 days), which shields semaglutide from renal clearance and proteolysis.

Additional Mechanisms

PathwayEffectSignificance
POMC/CART activationStimulates anorexigenic neurons in hypothalamusReduces appetite and food intake
NPY/AgRP inhibitionSuppresses orexigenic neuronsDecreases hunger drive
Delayed gastric emptyingSlows food transit from stomachProlongs satiety, reduces glucose spikes
WAT→BAT browningMay promote white-to-brown fat conversion via FNDC5/irisinIncreases energy expenditure
Cardiovascular protectionReduces atherosclerosis progression, inflammation20% reduction in MACE events (SELECT trial)

Evidence Base

Semaglutide has the most robust clinical evidence of any therapeutic peptide, with multiple large Phase III randomized controlled trials.

Study AreaDesignKey FindingsEvidence
SUSTAIN trialsPhase III RCTs, T2D, n=8,000+Superior HbA1c reduction vs comparators; dose-dependent weight lossLevel I
STEP 1-5Phase III RCTs, obesity, n=4,500+15-17% mean weight loss from baseline at 68 weeks; 30%+ of patients lost ≥20%Level I
SELECTPhase III RCT, CV outcomes, n=17,60420% reduction in major adverse cardiovascular events vs placeboLevel I
PIONEERPhase III, oral semaglutideOral 14mg daily showed significant HbA1c and weight reduction; GI side effects commonLevel I
OASIS 1Phase III, oral high-dose obesityOral 50mg showed ~16% weight loss — comparable to injectableLevel I
Key Limitation

Weight regain after discontinuation is significant. In the STEP 1 extension study, participants regained approximately two-thirds of lost weight within one year of stopping semaglutide. This suggests semaglutide treats obesity as a chronic condition requiring ongoing medication, similar to how statins manage cholesterol.

Safety & Side Effects

GI side effects: Nausea (40-44%), vomiting, diarrhea, and constipation are the most common adverse effects. Typically mild-to-moderate and improve with dose escalation over 4-8 weeks.

Thyroid cancer (boxed warning): GLP-1 agonists caused thyroid C-cell tumors in rodents. No increased risk confirmed in humans, but semaglutide is contraindicated in patients with personal/family history of medullary thyroid carcinoma (MTC) or MEN2.

Pancreatitis: Rare cases of acute pancreatitis reported. Patients should seek immediate care for severe persistent abdominal pain.

Gallbladder disease: Increased risk of cholelithiasis (gallstones) associated with rapid weight loss.

Muscle mass loss: 15-40% of weight lost may be lean mass. Resistance training and adequate protein intake are recommended during treatment.

Regulatory Status

JurisdictionStatus
FDAApproved: Ozempic (T2D, 2017), Wegovy (obesity, 2021), Rybelsus (oral T2D, 2019/2025)
EMAApproved for T2D and weight management
WADANot banned (legitimate medication)

Semaglutide vs Tirzepatide

FeatureSemaglutideTirzepatide
ClassGLP-1 receptor agonistDual GLP-1/GIP receptor agonist
Size31 amino acids39 amino acids
Weight loss15-17% (STEP trials)20-22% (SURMOUNT trials)
MechanismGLP-1 receptor onlyBoth GLP-1 and GIP receptors
DosingOnce weekly SCOnce weekly SC
Brand namesOzempic, Wegovy, RybelsusMounjaro, Zepbound
ManufacturerNovo NordiskEli Lilly

Analyze in the Design Lab

Explore More Peptides

Browse the full encyclopedia or dive deep into another peptide's mechanism and evidence.

Full Encyclopedia →