Home Encyclopedia What Is a Peptide Therapy Guide Blog Flashcards MCAT Practice NEET Practice Design Lab Clinical Docs AI Dashboard
Peptide Deep Dive · Evidence-Based Review

Tirzepatide

Dual GLP-1/GIP Receptor Agonist · Mounjaro · Zepbound

A 39-amino-acid 'twincretin' that activates both GLP-1 and GIP receptors simultaneously. Achieves up to 22.5% weight loss — the most effective anti-obesity medication ever approved.

39 amino acids
~5 day half-life
FDA approved
22.5% max weight loss
Dual receptor agonist
Educational content only. Not medical advice. This peptide may not be FDA-approved. Full disclaimer →
Category
Dual GLP-1/GIP
Route
SC injection
Dose
2.5–15 mg/week
Approval
FDA 2022
Evidence
Phase III RCTs

What Is Tirzepatide?

Tirzepatide is the first dual GLP-1/GIP receptor agonist — sometimes called a 'twincretin' — approved for clinical use. It simultaneously activates both incretin hormone receptors, producing synergistic effects on blood sugar control and weight loss that exceed what either pathway achieves alone.

Developed by Eli Lilly and marketed as Mounjaro (diabetes) and Zepbound (obesity), tirzepatide achieved unprecedented weight loss in clinical trials. In the SURMOUNT-1 trial, patients on the highest dose lost an average of 22.5% of their body weight — results comparable to bariatric surgery.

Core Concept
Tirzepatide is built on a GIP backbone but engineered to cross-react with the GLP-1 receptor. By activating both incretin receptors, it achieves complementary effects: GLP-1R activation drives appetite suppression and insulin secretion, while GIPR activation enhances fat metabolism and may improve insulin sensitivity through distinct pathways. The C20 fatty diacid enables albumin binding for once-weekly dosing.

Amino Acid Sequence

Tirzepatide Primary Structure
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4,813.5 Da · 39 residues · Based on GIP sequence with GLP-1R cross-reactivity engineered in
Open in Design Lab →

Tirzepatide's sequence is based on the native GIP hormone but has been engineered at key positions to also activate the GLP-1 receptor. This cross-reactivity was achieved through specific amino acid substitutions that allow the peptide to bind in both receptor pockets — a remarkable feat of peptide engineering.

Mechanism of Action

Tirzepatide's dual mechanism distinguishes it from pure GLP-1 agonists. The GLP-1 receptor activation provides the same benefits as semaglutide — glucose-dependent insulin, glucagon suppression, delayed gastric emptying, and central appetite suppression. The additional GIP receptor activation adds complementary effects on adipose tissue metabolism and potentially on bone health.

Tirzepatide Dual Agonism
Binds
GLP-1R + GIPR
GLP-1R
↑Insulin, ↓Glucagon, ↓Appetite
GIPR
↑Fat metabolism, ↑Insulin sensitivity
Combined
Synergistic metabolic effects
Result
Weight loss + Glycemic control

Additional Mechanisms

PathwayEffectSignificance
GIP receptor activationEnhances fat tissue metabolism and energy expenditureMay promote more favorable body composition during weight loss
β-cell functionDual receptor stimulation more effectively restores β-cell glucose sensitivitySuperior glycemic control vs GLP-1 alone
Lipid metabolismReduces triglycerides and improves cholesterol profileCardiovascular risk reduction beyond weight loss
Bone metabolismGIP signaling may protect against bone loss during weight lossPotential advantage over GLP-1-only agents

Evidence Base

Tirzepatide's clinical trial program is among the most impressive in metabolic disease history.

Study AreaDesignKey FindingsEvidence
SURMOUNT-1Phase III, obesity, n=2,53922.5% mean weight loss at highest dose (15mg); 63% lost ≥20% body weightLevel I
SURPASS 1-5Phase III, T2D, n=6,000+Superior HbA1c reduction vs semaglutide, insulin, and placeboLevel I
SURMOUNT-MMOPhase III, CV outcomesOngoing; evaluating MACE reduction in obesityPending
Sleep apneaPhase III (Zepbound)FDA-approved for moderate-severe obstructive sleep apnea in adults with obesity (Dec 2024)Level I

Safety & Side Effects

GI side effects: Similar profile to GLP-1 agonists: nausea (~25-30%), diarrhea, vomiting. Generally improves with gradual dose titration.

Thyroid warning: Same boxed warning as GLP-1 agonists for thyroid C-cell tumors in rodents. Contraindicated with MTC history.

Pancreatitis risk: Rare acute pancreatitis cases reported. Same monitoring recommendations as GLP-1 class.

Injection site reactions: Mild injection site reactions in ~3-5% of patients.

Regulatory Status

JurisdictionStatus
FDAApproved: Mounjaro (T2D, 2022), Zepbound (obesity, 2023; OSA, 2024)
EMAApproved for T2D and weight management
WADANot banned

Analyze in the Design Lab

Explore More Peptides

Browse the full encyclopedia or dive deep into another peptide's mechanism and evidence.

Full Encyclopedia →