Home Encyclopedia What Is a Peptide Therapy Guide Blog Flashcards MCAT Practice NEET Practice Design Lab Clinical Docs AI Dashboard
Peptide Deep Dive

CJC-1295

Growth Hormone Releasing Hormone Analog · GHRH · DAC

A 30-amino-acid synthetic analog of growth hormone-releasing hormone (GHRH) modified for extended half-life. Often combined with Ipamorelin (a growth hormone secretagogue). One of the most popular peptides in the biohacking and anti-aging communities.

30 amino acids
GHRH analog
DAC for long half-life
Not FDA-approved
Often paired with Ipamorelin
Educational content only. Not medical advice. This peptide may not be FDA-approved. Full disclaimer →
Category
Growth Hormone Releasing
Route
SC injection
Half-life
~6-8 days (with DAC)
Human Data
Phase II trials
Evidence
Moderate clinical

What Is CJC-1295?

CJC-1295 is a synthetic 30-amino-acid peptide analog of the first 29 amino acids of human growth hormone-releasing hormone (GHRH 1-29, also known as Sermorelin). It was developed by ConjuChem Biotechnologies with a key innovation: the addition of a Drug Affinity Complex (DAC) — a reactive chemical group that covalently binds to serum albumin after injection.

CJC-1295 is commonly paired with Ipamorelin, a pentapeptide growth hormone secretagogue that acts on the ghrelin receptor (GHS-R). Together, they provide complementary stimulation of growth hormone release — CJC-1295 mimics the natural GHRH signal while Ipamorelin amplifies it through a separate receptor pathway.

Core Concept
CJC-1295 stimulates growth hormone release by binding to the GHRH receptor on pituitary somatotroph cells, triggering the Gs-cAMP-PKA signaling cascade that promotes GH gene transcription and secretion. The DAC modification covalently attaches CJC-1295 to albumin in vivo, extending its half-life from ~30 minutes (native GHRH) to 6-8 days, maintaining elevated GH pulsatility without the supraphysiological spikes seen with direct GH injection.

Structure & Sequence

CJC-1295
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
MW: 3,647.28 Da · 30 residues
Open in Design Lab →

Mechanism of Action

CJC-1295 binds the GHRH receptor on anterior pituitary somatotrophs, activating the Gs-adenylyl cyclase-cAMP-PKA cascade. This stimulates both GH gene transcription and release of stored GH granules. Unlike exogenous GH injection (which suppresses the body's own GH production via negative feedback), CJC-1295 works through the natural signaling axis, preserving the pulsatile pattern of GH secretion that is important for optimal tissue response.

CJC-1295 GH Stimulation
CJC-1295
binds GHRH receptor
Activates
Gs → cAMP → PKA
Stimulates
GH gene transcription
Pituitary
releases Growth Hormone
GH acts on
Liver → IGF-1
Result
Growth, repair, metabolism

Key Mechanisms

PathwayEffectSignificance
GH releaseStimulates pulsatile GH secretion from pituitary somatotrophsIncreases GH levels 2-10x above baseline for days
IGF-1 increaseGH stimulates hepatic IGF-1 productionMediates most of GH's anabolic effects on muscle, bone, and connective tissue
Fat metabolismGH promotes lipolysis in adipose tissueReduces body fat percentage, particularly visceral fat
Albumin binding (DAC)Reactive group forms covalent bond with Cys34 of serum albuminExtends half-life from ~30 min to 6-8 days
Preserved pulsatilityWorks through the natural GHRH axisAvoids the flat GH levels and side effects of direct GH injection

Evidence Base

StudyDesignFindingsLevel
Phase I/II (ConjuChem)Human trials, n=small2-10x increase in GH levels sustained for 6+ days after single dose; dose-dependent IGF-1 increaseLevel II
Body compositionClinical studyIncreased lean mass, decreased fat mass over 12 weeks in GH-deficient subjectsLevel II
Ipamorelin comboClinical researchSynergistic GH release when CJC-1295 + Ipamorelin administered togetherLevel II-III
Sleep qualityObservationalAnecdotal and small-study reports of improved deep sleep (GH is primarily released during slow-wave sleep)Level III-IV

Safety & Side Effects

Injection site reactions: Redness, swelling at injection site are common and usually mild.

Water retention: GH increase can cause fluid retention, joint stiffness, and carpal tunnel-like symptoms.

Potential cancer risk: GH and IGF-1 promote cell growth. Long-term GH elevation theoretically increases cancer risk, though direct evidence is limited.

Glucose effects: GH is counter-regulatory to insulin. Chronic GH elevation may impair glucose tolerance.

Regulatory Status

JurisdictionStatus
FDANot approved. ConjuChem's clinical program was discontinued.
WADABanned under S2 (Peptide hormones and growth factors)
Legal statusAvailable as a research chemical in many jurisdictions

Analyze in Design Lab

Explore More Peptides

Browse the full encyclopedia.

Full Encyclopedia →