Peptides
All Peptides ★ Seeds Pillar Peptides FDA Status Tracker
Tools
Which Peptide Is Right? Peptide Comparison Design Lab Clinical Docs AI
Guides
What Is a Peptide Peptide Therapy Guide Seeds Protocols Collagen Peptides Skincare Peptides Blog & Articles
Encyclopedia
Peptide Encyclopedia
For Practitioners
Sourcing Standards FAQ
For Students
Flashcards MCAT Practice NEET Practice Study Guide
Peptide Deep Dive

Liraglutide

Victoza · Saxenda · GLP-1 Agonist · First Long-Acting Incretin

A 31-amino-acid GLP-1 analog with 97% homology to native GLP-1. The first long-acting GLP-1 receptor agonist, enabling once-daily dosing. FDA-approved as Victoza (diabetes) and Saxenda (obesity). Paved the way for semaglutide.

31 amino acids
~13 hour half-life
FDA approved
Once daily dosing
Pioneer of GLP-1 class
By PeptideBond Editorial Team·Sources: PubMed, FDA.gov, published clinical trials·Last updated: March 2026
Educational only — not medical advice.Disclaimer
Category
GLP-1 Agonist
Route
SC injection (daily)
Dose
0.6-3.0 mg/day
Approval
FDA 2010/2014
Evidence
Phase III RCTs

What Is Liraglutide?

Liraglutide is a 31-amino-acid GLP-1 analog that was the first long-acting incretin mimetic to reach the market. Developed by Novo Nordisk and approved in 2010, it demonstrated that GLP-1 receptor agonism could be a viable therapeutic strategy for both Type 2 diabetes and obesity.

Liraglutide has 97% sequence homology to native GLP-1 (one amino acid change: Lys34→Arg34) plus a C16 fatty acid (palmitic acid) attached to Lys26 via a glutamic acid spacer. This fatty acid enables albumin binding, extending the half-life from 2 minutes (native GLP-1) to approximately 13 hours — enabling once-daily injection.

Core Concept
Liraglutide works through the same GLP-1 receptor mechanism as semaglutide — glucose-dependent insulin secretion, glucagon suppression, delayed gastric emptying, and central appetite suppression. The key difference is its shorter half-life (13 hours vs 7 days for semaglutide), requiring daily rather than weekly injection. Liraglutide produces less weight loss than semaglutide (~8% vs 15-17%) but was the proof-of-concept drug that validated the entire GLP-1 agonist class.

Liraglutide was Novo Nordisk's first long-acting GLP-1 receptor agonist and the direct predecessor to semaglutide. Approved as Victoza for Type 2 diabetes in 2010 and as Saxenda for weight management in 2014, liraglutide proved that GLP-1-based therapy could produce clinically meaningful weight loss — paving the way for semaglutide's later, more dramatic results. The LEADER trial (2016) established that liraglutide reduces cardiovascular events in patients with Type 2 diabetes, making it the first GLP-1 agonist with proven CV benefit.

Structurally, liraglutide achieves its extended half-life (~13 hours, enabling once-daily dosing) through a C16 fatty acid (palmitic acid) attached to Lys26 via a glutamic acid spacer. This fatty acid enables albumin binding in the bloodstream, slowing renal clearance. Semaglutide improved on this approach with a C18 fatty diacid and additional DPP-4 resistance modifications, achieving a ~7-day half-life and the shift from daily to weekly dosing.

While semaglutide has largely supplanted liraglutide for new prescriptions, Saxenda remains widely prescribed for weight management and is an important option for patients who prefer daily dosing or who experience better GI tolerability with the shorter-acting formulation.

>Structure & Sequence

Liraglutide
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
MW: 3,751.2 Da · 31 residues
Open in Design Lab →

Mechanism of Action

Liraglutide's mechanism is identical to native GLP-1 and semaglutide — it binds and activates the GLP-1 receptor, a Gs-coupled GPCR. The clinical differences between liraglutide and semaglutide are pharmacokinetic, not pharmacodynamic: liraglutide's C16 fatty acid provides sufficient albumin binding for once-daily dosing, while semaglutide's C18 fatty diacid provides stronger albumin affinity for once-weekly dosing.

Liraglutide GLP-1 Mechanism
Binds
GLP-1 receptor
Activates
cAMP → PKA
Pancreas
↑Insulin, ↓Glucagon
Stomach
Delayed emptying
Brain
Appetite suppression
Result
Glycemic control + Weight loss

Key Mechanisms

PathwayEffectSignificance
Insulin secretionGlucose-dependent β-cell stimulationLowers blood sugar only when glucose is elevated — low hypoglycemia risk
Glucagon suppressionReduces α-cell glucagon outputPrevents excessive hepatic glucose production
Gastric emptyingSlows food transit from stomachReduces postprandial glucose spikes and increases satiety
Appetite suppressionCNS GLP-1R activation in hypothalamusAverage 8% weight loss (Saxenda 3.0 mg dose)
CardioprotectionReduces atherosclerosis and inflammation13% reduction in MACE in LEADER trial

Evidence Base

StudyDesignFindingsLevel
LEAD programPhase III, T2D, multiple trialsSuperior HbA1c reduction vs sulfonylureas and comparable to insulin; significant weight lossLevel I
SCALE programPhase III, obesity, n=3,7318% mean weight loss at 3.0 mg dose over 56 weeks (Saxenda)Level I
LEADER trialPhase III, CV outcomes, n=9,34013% reduction in major adverse cardiovascular events (MACE) vs placeboLevel I
Pediatric obesityPhase IIIApproved for adolescents (12-17) with obesity. Significant BMI reduction vs placebo.Level I

Safety & Side Effects

GI side effects: Nausea (occurring in ~25-40% of patients), vomiting, and diarrhea are the most common adverse effects. The once-daily dosing means patients experience a daily peak-and-trough cycle of GLP-1 receptor activation, which some patients tolerate better and others worse compared to the more sustained levels produced by weekly semaglutide.

Thyroid C-cell tumors: Same boxed warning as all GLP-1 agonists — rodent studies showed thyroid C-cell tumors. Contraindicated with MTC or MEN2 history.

Pancreatitis: Rare cases of acute pancreatitis reported. Same monitoring recommendations as the GLP-1 class.

Cardiovascular benefit: The LEADER trial demonstrated a 13% reduction in MACE (major adverse cardiovascular events) — making liraglutide one of the few diabetes drugs with proven cardiovascular benefit.

Weight loss magnitude: Saxenda (3.0 mg daily) produces approximately 5-8% body weight loss — meaningful but substantially less than semaglutide 2.4 mg weekly (15-17%) or tirzepatide (20-22%). This difference in efficacy, combined with the convenience of weekly vs daily dosing, is the primary reason semaglutide has become the dominant GLP-1 therapy.

Regulatory Status

JurisdictionStatus
FDAApproved: Victoza (T2D, 2010), Saxenda (obesity, 2014)
EMAApproved for T2D and weight management
HistoricalFirst long-acting GLP-1 agonist. Proof-of-concept for the entire class.

Liraglutide vs Semaglutide

FeatureLiraglutideSemaglutide
Half-life~13 hours (daily injection)~7 days (weekly injection)
Weight loss~8% (SCALE trials)~15-17% (STEP trials)
Fatty acidC16 palmitic acidC18 fatty diacid
DPP-4 resistanceLys34→Arg34 onlyAla8→Aib (steric shield)
DosingOnce dailyOnce weekly
Market positionFirst-to-market GLP-1Market leader

Analyze in Design Lab

Explore More Peptides

Browse the full directory.

Full Directory →