Home Encyclopedia What Is a Peptide Therapy Guide Blog Flashcards MCAT Practice NEET Practice Design Lab Clinical Docs AI Dashboard
Peptide Deep Dive

Liraglutide

Victoza · Saxenda · GLP-1 Agonist · First Long-Acting Incretin

A 31-amino-acid GLP-1 analog with 97% homology to native GLP-1. The first long-acting GLP-1 receptor agonist, enabling once-daily dosing. FDA-approved as Victoza (diabetes) and Saxenda (obesity). Paved the way for semaglutide.

31 amino acids
~13 hour half-life
FDA approved
Once daily dosing
Pioneer of GLP-1 class
Educational content only. Not medical advice. This peptide may not be FDA-approved. Full disclaimer →
Category
GLP-1 Agonist
Route
SC injection (daily)
Dose
0.6-3.0 mg/day
Approval
FDA 2010/2014
Evidence
Phase III RCTs

What Is Liraglutide?

Liraglutide is a 31-amino-acid GLP-1 analog that was the first long-acting incretin mimetic to reach the market. Developed by Novo Nordisk and approved in 2010, it demonstrated that GLP-1 receptor agonism could be a viable therapeutic strategy for both Type 2 diabetes and obesity.

Liraglutide has 97% sequence homology to native GLP-1 (one amino acid change: Lys34→Arg34) plus a C16 fatty acid (palmitic acid) attached to Lys26 via a glutamic acid spacer. This fatty acid enables albumin binding, extending the half-life from 2 minutes (native GLP-1) to approximately 13 hours — enabling once-daily injection.

Core Concept
Liraglutide works through the same GLP-1 receptor mechanism as semaglutide — glucose-dependent insulin secretion, glucagon suppression, delayed gastric emptying, and central appetite suppression. The key difference is its shorter half-life (13 hours vs 7 days for semaglutide), requiring daily rather than weekly injection. Liraglutide produces less weight loss than semaglutide (~8% vs 15-17%) but was the proof-of-concept drug that validated the entire GLP-1 agonist class.

Structure & Sequence

Liraglutide
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG
MW: 3,751.2 Da · 31 residues
Open in Design Lab →

Mechanism of Action

Liraglutide's mechanism is identical to native GLP-1 and semaglutide — it binds and activates the GLP-1 receptor, a Gs-coupled GPCR. The clinical differences between liraglutide and semaglutide are pharmacokinetic, not pharmacodynamic: liraglutide's C16 fatty acid provides sufficient albumin binding for once-daily dosing, while semaglutide's C18 fatty diacid provides stronger albumin affinity for once-weekly dosing.

Liraglutide GLP-1 Mechanism
Binds
GLP-1 receptor
Activates
cAMP → PKA
Pancreas
↑Insulin, ↓Glucagon
Stomach
Delayed emptying
Brain
Appetite suppression
Result
Glycemic control + Weight loss

Key Mechanisms

PathwayEffectSignificance
Insulin secretionGlucose-dependent β-cell stimulationLowers blood sugar only when glucose is elevated — low hypoglycemia risk
Glucagon suppressionReduces α-cell glucagon outputPrevents excessive hepatic glucose production
Gastric emptyingSlows food transit from stomachReduces postprandial glucose spikes and increases satiety
Appetite suppressionCNS GLP-1R activation in hypothalamusAverage 8% weight loss (Saxenda 3.0 mg dose)
CardioprotectionReduces atherosclerosis and inflammation13% reduction in MACE in LEADER trial

Evidence Base

StudyDesignFindingsLevel
LEAD programPhase III, T2D, multiple trialsSuperior HbA1c reduction vs sulfonylureas and comparable to insulin; significant weight lossLevel I
SCALE programPhase III, obesity, n=3,7318% mean weight loss at 3.0 mg dose over 56 weeks (Saxenda)Level I
LEADER trialPhase III, CV outcomes, n=9,34013% reduction in major adverse cardiovascular events (MACE) vs placeboLevel I
Pediatric obesityPhase IIIApproved for adolescents (12-17) with obesity. Significant BMI reduction vs placebo.Level I

Safety & Side Effects

GI side effects: Nausea (39%), diarrhea, vomiting — similar profile to all GLP-1 agonists. Dose titration helps.

Thyroid warning: Same boxed warning as semaglutide for thyroid C-cell tumors in rodents. Contraindicated with MTC/MEN2 history.

Pancreatitis: Rare acute pancreatitis cases reported. Same monitoring as semaglutide.

Injection frequency: Daily injection is less convenient than weekly semaglutide — a major reason for semaglutide's market dominance.

Regulatory Status

JurisdictionStatus
FDAApproved: Victoza (T2D, 2010), Saxenda (obesity, 2014)
EMAApproved for T2D and weight management
HistoricalFirst long-acting GLP-1 agonist. Proof-of-concept for the entire class.

Liraglutide vs Semaglutide

FeatureLiraglutideSemaglutide
Half-life~13 hours (daily injection)~7 days (weekly injection)
Weight loss~8% (SCALE trials)~15-17% (STEP trials)
Fatty acidC16 palmitic acidC18 fatty diacid
DPP-4 resistanceLys34→Arg34 onlyAla8→Aib (steric shield)
DosingOnce dailyOnce weekly
Market positionFirst-to-market GLP-1Market leader

Analyze in Design Lab

Explore More Peptides

Browse the full encyclopedia.

Full Encyclopedia →