Home Encyclopedia What Is a Peptide Therapy Guide Blog Flashcards MCAT Practice NEET Practice Design Lab Clinical Docs AI Dashboard
Peptide Deep Dive

LL-37

Cathelicidin · Human Antimicrobial Peptide · Innate Immunity

A 37-amino-acid peptide and the only cathelicidin antimicrobial peptide in humans. The primary effector molecule of the innate immune system's first line of defense against bacterial, viral, and fungal pathogens. Also modulates adaptive immunity, wound healing, and inflammation.

37 amino acids
Only human cathelicidin
Innate immune defense
Antimicrobial + immunomodulatory
Amphipathic α-helix
Educational content only. Not medical advice. This peptide may not be FDA-approved. Full disclaimer →
Category
Antimicrobial peptide (AMP)
Source
Neutrophils, epithelial cells
Charge
+6 at pH 7.4
Structure
Amphipathic α-helix
Evidence
Extensive preclinical + clinical genetics

What Is LL-37?

LL-37 (named for its two N-terminal leucines and 37-residue length) is the only member of the cathelicidin antimicrobial peptide family in humans. It is produced by neutrophils, macrophages, and epithelial cells of the skin, gut, and respiratory tract as a first-line defense against microbial invasion.

LL-37 is cleaved from its precursor protein hCAP-18 (human cationic antimicrobial protein, 18 kDa) by proteinase 3 in neutrophils or by kallikreins in skin. Its expression is upregulated by vitamin D — which is why vitamin D deficiency is associated with increased susceptibility to infections like tuberculosis.

Core Concept
LL-37 has dual antimicrobial and immunomodulatory functions. As an AMP, it kills bacteria by membrane disruption (similar to melittin but with greater selectivity for bacterial membranes). As an immunomodulator, it recruits immune cells to infection sites, promotes wound healing, modulates dendritic cell function, and can neutralize bacterial endotoxin (LPS). The vitamin D connection makes LL-37 a molecular link between vitamin D status and immune function.

Structure & Sequence

LL-37
[LL-37, 37 aa]
MW: 4,493.3 Da · 37 residues
Open in Design Lab →

Mechanism of Action

LL-37 adopts an amphipathic α-helical structure upon contact with bacterial membranes. Like melittin, its cationic charge (+6) attracts it to anionic bacterial membranes, and its hydrophobic face inserts into the lipid bilayer. However, LL-37 has better selectivity for bacterial vs human membranes than melittin, making it less toxic to host cells. Beyond direct killing, LL-37 signals through formyl peptide receptor-like 1 (FPRL1) and P2X7 receptors to recruit and activate immune cells.

LL-37 Dual Function
Released from
Neutrophils / Epithelium
Antimicrobial
Membrane disruption of pathogens
Immunomodulatory
Immune cell recruitment
Wound healing
Epithelial cell migration
LPS neutralization
Blocks endotoxin signaling
Result
Broad-spectrum innate defense

Key Mechanisms

PathwayEffectSignificance
Membrane disruptionAmphipathic helix inserts into bacterial membranes causing lysisBroad-spectrum activity against Gram+, Gram−, fungi, and some viruses
ChemotaxisActivates FPRL1 on neutrophils, monocytes, and T-cellsRecruits immune cells to infection sites
LPS neutralizationBinds and neutralizes bacterial endotoxinPrevents septic shock signaling through TLR4
Wound healingPromotes keratinocyte migration and angiogenesisAccelerates epithelial barrier repair
Vitamin D regulationLL-37 gene (CAMP) is transcriptionally activated by vitamin D receptorExplains the vitamin D-infection susceptibility connection

Evidence Base

StudyDesignFindingsLevel
Genetic studiesHuman cohortsLL-37 deficiency (Kostmann syndrome, specific granule deficiency) causes severe recurrent infections. Confirms essential role in immunity.Level I (genetic)
Vitamin D connectionObservational + mechanisticVitamin D supplementation increases LL-37 expression. Low vitamin D → low LL-37 → increased TB susceptibility.Level I-II
Wound healingPreclinical + clinical pilotTopical LL-37 promotes chronic wound healing (diabetic ulcers). Phase I/II studies ongoing.Level II
Anti-biofilmIn vitro/in vivoLL-37 disrupts bacterial biofilms, including MRSA and Pseudomonas biofilmsPreclinical
COVID-19ObservationalLow LL-37 levels associated with more severe COVID-19 outcomes. Vitamin D supplementation trials ongoing.Level II-III

Safety & Side Effects

Endogenous peptide: LL-37 is naturally produced by the body. Exogenous administration mimics a natural defense mechanism.

Hemolysis at high doses: Like all AMPs, LL-37 can damage red blood cells at concentrations above physiological levels.

Pro-inflammatory potential: Excessive LL-37 is implicated in autoimmune conditions (psoriasis, rosacea, lupus) where it forms complexes with self-DNA that activate TLR9.

Regulatory Status

JurisdictionStatus
FDANot approved as a drug. Clinical trials ongoing for wound healing.
ResearchOne of the most studied AMPs in the world. >5,000 publications.
Vitamin D connectionPublic health implication: vitamin D supplementation as an indirect way to boost LL-37 levels

Analyze in Design Lab

Explore More Peptides

Browse the full encyclopedia.

Full Encyclopedia →