Peptides
All Peptides ★ Seeds Pillar Peptides FDA Status Tracker
Tools
Which Peptide Is Right? Peptide Comparison Design Lab Clinical Docs AI
Guides
What Is a Peptide Peptide Therapy Guide Seeds Protocols Collagen Peptides Skincare Peptides Blog & Articles
Encyclopedia
Peptide Encyclopedia
For Practitioners
Sourcing Standards FAQ
For Students
Flashcards MCAT Practice NEET Practice Study Guide
Peptide Deep Dive

Sermorelin

GHRH 1-29 · Geref · Growth Hormone Releasing Peptide

A 29-amino-acid peptide corresponding to the first 29 residues of natural GHRH (1-44). The shortest fragment that retains full biological activity. FDA-approved as a diagnostic agent for GH deficiency and formerly approved for GH-deficient children.

29 amino acids
GHRH 1-29 fragment
FDA approved (diagnostic)
Natural sequence
First GHRH therapeutic
By PeptideBond Editorial Team·Sources: PubMed, FDA.gov, published clinical trials·Last updated: March 2026
Educational only — not medical advice.Disclaimer
Category
GH Releasing
Route
SC / IV injection
Half-life
~10-20 minutes
Approval
FDA (diagnostic)
Evidence
Clinical

What Is Sermorelin?

Sermorelin (GHRH 1-29) is a 29-amino-acid peptide that is the biologically active fragment of the 44-amino-acid growth hormone-releasing hormone. It was the first GHRH-based therapeutic developed, demonstrating that only the first 29 residues are needed for full GHRH receptor activation.

Unlike exogenous GH injection, sermorelin stimulates the pituitary to produce and release its own GH through the natural GHRH receptor pathway. This preserves the physiological pulsatile pattern of GH secretion and allows the body's feedback mechanisms to prevent excess GH levels.

Core Concept
Sermorelin binds the GHRH receptor (a Gs-coupled GPCR) on anterior pituitary somatotrophs, activating adenylyl cyclase and increasing cAMP, which triggers GH gene transcription and granule release. Its short half-life (~10-20 min) means it produces a GH pulse similar to natural GHRH, but it requires frequent dosing. CJC-1295 was developed specifically to solve this half-life limitation.

Sermorelin is the shortest functional fragment of GHRH — the first 29 amino acids of the 44-amino-acid native hormone — and retains full biological activity at the GHRH receptor. It was FDA-approved in 1997 as a diagnostic agent for GH deficiency in children (marketed as Geref Diagnostic) but was withdrawn from the market in 2008 for commercial reasons, not safety concerns. Despite the FDA withdrawal, sermorelin remained one of the most widely prescribed GH-stimulating peptides in anti-aging and functional medicine.

Sermorelin's appeal lies in its physiological approach to GH optimization. Rather than administering exogenous growth hormone directly (which suppresses the body's own GH production via negative feedback), sermorelin stimulates the pituitary gland to produce and release its own GH in natural pulsatile patterns. This preserves the hypothalamic-pituitary feedback loop and is considered a safer long-term approach than direct GH replacement.

As of early 2026, sermorelin remains available for compounding — it was not placed on the FDA's Category 2 restricted list, likely because it had prior FDA approval and a well-established safety profile. It continues to be one of the most commonly prescribed peptides for age-related GH decline.

>Structure & Sequence

Sermorelin
YADAIFTNSYRKVLGQLSARKLLQDIMSRN
MW: 3,357.9 Da · 29 residues
Open in Design Lab →

Mechanism of Action

Sermorelin is the prototypical GHRH receptor agonist. It activates the same Gs-cAMP-PKA cascade as native GHRH, stimulating both GH gene transcription and release of stored GH granules from somatotrophs.

Sermorelin GH Stimulation
Binds
GHRH receptor
Activates
Gs → cAMP → PKA
Stimulates
GH synthesis + release
Pituitary
pulses GH naturally
Result
Growth + Repair

Key Mechanisms

PathwayEffectSignificance
GHRH-R agonismFull activation of GHRH receptor with first 29 residuesIdentical signaling to native GHRH 1-44
Pulsatile GHShort half-life produces natural GH pulsesPreserves physiological GH secretion pattern
IGF-1 stimulationGH-mediated hepatic IGF-1 productionDownstream growth, repair, and metabolic effects
No GH suppressionWorks through natural axis, not exogenous replacementBody's feedback prevents excess GH

Evidence Base

StudyDesignFindingsLevel
GH deficiency diagnosisFDA-approved diagnosticIV sermorelin measures pituitary GH reserve. Normal response rules out pituitary cause of GH deficiency.Level I
Pediatric GH deficiencyFormer FDA indicationStimulated growth in GH-deficient children. Withdrawn from market (2008) for commercial reasons, not safety.Level I
Anti-agingClinical studiesIncreased IGF-1, improved body composition, sleep quality in adults. Off-label use common.Level II-III

Safety & Side Effects

Well-established safety profile: Sermorelin has the most extensive human safety data of any GH secretagogue, having been FDA-approved (albeit for diagnostic use) and used clinically for decades. No serious adverse events have been attributed to sermorelin at therapeutic doses in the published literature.

Injection site reactions: Pain, redness, or swelling at the subcutaneous injection site are the most commonly reported side effects. These are typically mild and self-limiting.

Flushing and headache: Transient facial flushing, dizziness, and headache have been reported, particularly with the first few doses. These effects typically diminish with continued use.

GH-related effects: Water retention, joint stiffness, and carpal tunnel-like symptoms can occur if GH levels are elevated significantly, though these are less common with sermorelin than with direct GH administration because the pituitary's natural regulatory mechanisms remain intact.

Advantages over direct GH: Because sermorelin works through the body's own GH production pathway, it maintains the pulsatile pattern of GH release and preserves negative feedback regulation. This means the risk of GH excess (and its associated side effects) is lower than with exogenous GH injection.

Regulatory Status

JurisdictionStatus
FDAApproved as diagnostic (Geref). Former therapeutic approval withdrawn 2008 (commercial, not safety).
WADABanned under S2
StatusLargely replaced by CJC-1295 and tesamorelin in clinical use

Sermorelin vs CJC-1295

FeatureSermorelinCJC-1295
Length29 amino acids30 amino acids
Half-life10-20 minutes6-8 days (with DAC)
DosingDaily injectionWeekly injection
ModificationNone (natural sequence)DAC for albumin binding
FDA statusApproved (diagnostic)Not approved

Analyze in Design Lab

Explore More Peptides

Browse the full directory.

Full Directory →